Mouse Anti-BLOC1S1 Antibody (CBMOAB-37003FYA)


Cat: CBMOAB-37003FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37003FYA Monoclonal Rhesus (Macaca mulatta), A. thaliana (Arabidopsis thaliana), Plant, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO37003FYA 100 µg
CBMOAB-67720FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67720FYA 100 µg
MO-AB-01875H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01875C 100 µg
MO-AB-08104R Monoclonal Cattle (Bos taurus) WB, ELISA MO08104R 100 µg
MO-AB-12978W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12978W 100 µg
MO-AB-24385H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24385C 100 µg
MO-AB-51883W Monoclonal Marmoset WB, ELISA MO51883W 100 µg
MO-DKB-00395W Polyclonal A. thaliana (Arabidopsis thaliana), Plant WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), A. thaliana (Arabidopsis thaliana), Plant, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO37003FYA
SpecificityThis antibody binds to Rhesus BLOC1S1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionBLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and Dell'Angelica, 2004 [PubMed 15102850]).
Product OverviewMouse Anti-Rhesus BLOC1S1 Antibody is a mouse antibody against BLOC1S1. It can be used for BLOC1S1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBiogenesis of lysosome-related organelles complex 1 subunit 1; BLOC1S1
UniProt IDH9Z1H3
Protein RefseqThe length of the protein is 153 amino acids long.
The sequence is show below: MAPGSRGELSSFRSRRGPGVPSPQPDVTMLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS.
For Research Use Only | Not For Clinical Use.
Online Inquiry