AibGenesis™ Mouse Anti-BNIP1 Antibody (CBMOAB-37034FYA)


Cat: CBMOAB-37034FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37034FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO37034FYA 100 µg
MO-AB-01901H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01901C 100 µg
MO-AB-08158R Monoclonal Cattle (Bos taurus) WB, ELISA MO08158R 100 µg
MO-AB-10914W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10914W 100 µg
MO-AB-24399H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24399C 100 µg
MO-AB-51909W Monoclonal Marmoset WB, ELISA MO51909W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO37034FYA
SpecificityThis antibody binds to Rhesus BNIP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Mitochondrion; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. In addition, this protein is involved in vesicle transport into the endoplasmic reticulum. Alternative splicing of this gene results in four protein products with identical N- and C-termini. (From NCBI)
Product OverviewMouse Anti-Rhesus BNIP1 Antibody is a mouse antibody against BNIP1. It can be used for BNIP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBNIP1
UniProt IDF7GPV1
Protein RefseqThe length of the protein is 270 amino acids long.
The sequence is show below: MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQPVLYQRAFINCFHFFFKLTYSLTDFSSTQHDFNSPTIPVTFSDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQTSWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL.
For Research Use Only | Not For Clinical Use.
Online Inquiry