Mouse Anti-Bsg Antibody (CBMOAB-02721FYA)


Cat: CBMOAB-02721FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-02721FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO02721FYA 100 µg
CBMOAB-67990FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67990FYA 100 µg
MO-AB-01336W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01336W 100 µg
MO-AB-01938H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01938C 100 µg
MO-AB-07368Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07368Y 100 µg
MO-AB-09152R Monoclonal Cattle (Bos taurus) WB, ELISA MO09152R 100 µg
MO-AB-10416W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10416W 100 µg
MO-AB-42971W Monoclonal Hamsters (Cricetinae) WB, ELISA MO42971W 100 µg
MO-AB-43870W Monoclonal Horse (Equus caballus) WB, ELISA MO43870W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO02721FYA
SpecificityThis antibody binds to fruit fly Bsg.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Cytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-D. melanogaster Bsg Antibody is a mouse antibody against Bsg. It can be used for Bsg detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBasigin, isoform J; Bsg
UniProt IDM9PCW5
Protein RefseqThe length of the protein is 266 amino acids long.
The sequence is show below: MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAEHQMKFYDIRSPLVLSCNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDDGKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELTWTFANVTLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAANVYGGNTTTPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRRNKSELEESDTDPQEHI.
For Research Use Only | Not For Clinical Use.
Online Inquiry