Mouse Anti-BTN2A2 Antibody (CBMOAB-37176FYA)


Cat: CBMOAB-37176FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37176FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis) WB, ELISA MO37176FYA 100 µg
MO-AB-01342W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01342W 100 µg
MO-AB-01955H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01955C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis)
CloneMO37176FYA
SpecificityThis antibody binds to Rhesus BTN2A2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionButyrophilin is the major protein associated with fat droplets in the milk. This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin gene superfamily. The encoded protein is a type I receptor glycoprotein involved in lipid, fatty-acid and sterol metabolism. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus BTN2A2 Antibody is a mouse antibody against BTN2A2. It can be used for BTN2A2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBTN2A2
UniProt IDF6RTT9
Protein RefseqThe length of the protein is 371 amino acids long.
The sequence is show below: IKVQEDGSIWLECISRGWYPEPLTVWRDPYSEIVPALKEVSIADADGLFMVTTAVIIRDKSVRNVSCSVNNTLLSQEKETVIFIPESFMPSTSPWMVALAVILTTSPWMVICCIKKLQREKKILSGEKEVEQEEKEIARKEFGKKEMHSSSNKGLGLSLQLQEELRWRRTFLHAADVVLDPDTAHPELFLSEDRRSVRRGPYRQRVPDNPERFDSQPCVLGWESFASGKHYWEVEVENVMVWTVGVCRDSVERKGEVLLIPQNGFWTLEMFGNQYRALSSPDRILPLKESLCRVGVFLHYEAGDVSFYNMRDRSHIYTCPRSAFSVPVRPFFRIGSDDSPIFICPALTGANGVTVPEEGLTLHRVGTQESL.
For Research Use Only | Not For Clinical Use.
Online Inquiry