Cat: CBMOAB-00146HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | C. elegans (Caenorhabditis elegans) |
Clone | MO00146HB |
Specificity | This antibody binds to C. elegans 5N224. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2 weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-C. elegans 5N224 (clone MO00146HB) Antibody (CBMOAB-00146HCB) is a mouse antibody against 5N224. It can be used for 5N224 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | 5N224; Protein C15C8.7; 5N224 |
UniProt ID | G5EC11 |
Protein Refseq | The length of the protein is 74 amino acids long. The sequence is show below: MFDRLLSQFGRKRVASESVATQQQLTDRTNVYTVKPQDPLLDKKQKMTPVQKVCLKCLAGESGHITHVLSSLSN. |
For Research Use Only | Not For Clinical Use.