Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-C. elegans CED2 Antibody (CBMOAB-01255HCB)

Cat: CBMOAB-01255HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details


Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
SpecificityThis antibody binds to C. elegans CED2.
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.


Product OverviewMouse Anti-C. elegans CED2 (clone MO01255HB) Antibody (CBMOAB-01255HCB) is a mouse antibody against CED2. It can be used for CED2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein CED-2, isoform c; ced-2
UniProt IDU4PRV3
Protein RefseqThe length of the protein is 29 amino acids long. The sequence is show below: MSNGMYKAELDGQIGSVPHTYLRFTAVSE.
For Research Use Only | Not For Clinical Use.

Online Inquiry