Mouse Anti-C. elegans CED2 (clone MO01255HB) Antibody (CBMOAB-01255HCB)

Cat: CBMOAB-01255HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details


Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
SpecificityThis antibody binds to C. elegans CED2.
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.


Product OverviewMouse Anti-C. elegans CED2 (clone MO01255HB) Antibody (CBMOAB-01255HCB) is a mouse antibody against CED2. It can be used for CED2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein CED-2, isoform c; ced-2
UniProt IDU4PRV3
Protein RefseqThe length of the protein is 29 amino acids long. The sequence is show below: MSNGMYKAELDGQIGSVPHTYLRFTAVSE.
For Research Use Only | Not For Clinical Use.

Online Inquiry