Cat: CBMOAB-01255HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | C. elegans (Caenorhabditis elegans) |
Clone | MO01255HB |
Specificity | This antibody binds to C. elegans CED2. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2 weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-C. elegans CED2 (clone MO01255HB) Antibody (CBMOAB-01255HCB) is a mouse antibody against CED2. It can be used for CED2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein CED-2, isoform c; ced-2 |
UniProt ID | U4PRV3 |
Protein Refseq | The length of the protein is 29 amino acids long. The sequence is show below: MSNGMYKAELDGQIGSVPHTYLRFTAVSE. |
See other products for " CED2 "
CBMOAB-01254HCB | Mouse Anti-C. elegans CED2 Antibody (CBMOAB-01254HCB) |
CBMOAB-01253HCB | Mouse Anti-C. elegans CED2 Antibody (CBMOAB-01253HCB) |
For Research Use Only | Not For Clinical Use.