Mouse Anti-C. elegans CED9 (clone MO01264HB) Antibody (CBMOAB-01264HCB)


Cat: CBMOAB-01264HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
CloneMO01264HB
SpecificityThis antibody binds to C. elegans CED9.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPlays a major role in programmed cell death (PCD, apoptosis) (PubMed:7907274, PubMed:10688797). egl-1 binds to and directly inhibits the activity of ced-9, releasing the cell death activator ced-4 from a ced-9/ced-4 containing protein complex and allowing ced-4 to activate the cell-killing caspase ced-3 (PubMed:9024666, PubMed:9027313, PubMed:9604928, PubMed:12894216, PubMed:15383288, PubMed:16208361). During larval development, required for the elimination of transient presynaptic components downstream of egl-1 and upstream of ced-4 and ced-3 apoptotic pathway (PubMed:26074078).
Product OverviewMouse Anti-C. elegans CED9 (clone MO01264HB) Antibody (CBMOAB-01264HCB) is a mouse antibody against CED9. It can be used for CED9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesApoptosis regulator ced-9; Cell death protein 9; ced-9
UniProt IDP41958
Protein RefseqThe length of the protein is 280 amino acids long. The sequence is show below: MTRCTADNSLTNPAYRRRTMATGEMKEFLGIKGTEPTDFGINSDAQDLPSPSRQASTRRMSIGESIDGKINDWEEPRLDIEGFVVDYFTHRIRQNGMEWFGAPGLPCGVQPEHEMMRVMGTIFEKKHAENFETFCEQLLAVPRISFSLYQDVVRTVGNAQTDQCPMSYGRLIGLISFGGFVAAKMMESVELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFMTLGKQMKEDYERAEAEKVGRRKQNRRWSMIGAGVTAGAIGIVGVVVCGRMMFSLK.
For Research Use Only | Not For Clinical Use.

Online Inquiry