Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-C. elegans CEH45 Antibody (CBMOAB-00004HCB)


Cat: CBMOAB-00004HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
CloneMO00004HB
SpecificityThis antibody binds to C. elegans CEH45.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-C. elegans CEH45 (clone MO00004HB) Antibody (CBMOAB-00004HCB) is a mouse antibody against CEH45. It can be used for CEH45 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHomeobox domain-containing protein; ceh-45
Gene ID171689
UniProt IDV6CJ20
Protein RefseqThe length of the protein is 144 amino acids long. The sequence is show below: MLCGPLMPPFMAPYHHQHYASRRKRRHRTIFSEEQLNILETTFSTTHYPDATTREELAVQCSLKEERVEVWFKNRRAKERKQKKDDSRTSKHSGDDSECDESDEDTRKVKRIKRENSSGKETSSPESKASLKTSHSENLVLEPC.

See other products for " CEH45 "

For Research Use Only | Not For Clinical Use.

Online Inquiry