Cat: CBMOAB-00021HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | C. elegans (Caenorhabditis elegans) |
Clone | MO00021HB |
Specificity | This antibody binds to C. elegans COX3. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2 weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix. |
Product Overview | Mouse Anti-C. elegans COX3 (clone MO00021HB) Antibody (CBMOAB-00021HCB) is a mouse antibody against COX3. It can be used for COX3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | cytochrome c oxidase subunit III; COX3 |
Gene ID | 2565701 |
UniProt ID | P24891 |
Protein Refseq | The length of the protein is 255 amino acids long. The sequence is show below: MFHNFHILSLSSYAYNLFFASAGMLSSLVMFFKFGLYELFIFTLFSVLFISFAWGKDIAMEGLSGYHNFFVMDGFKFGVILFVFSEFMFFFCIFCTFFDAALVPVHELGETWSPFGMHLVNPFGVPLLNTIILLSSGVTVTWAHHSLLSNKSCTNSMILTCLLAAYFTGIQLMEYMEASFSIADGVFGSIFYLSTGFHGIHVLCGGLFLAFNFLRLLKNHFNYNHHLGLEFAILYWHFVDVVWLFLFVFVYWWSY. |
See other products for " Cox3 "
CBMOAB-13806FYA | Mouse Anti-D. melanogaster Cox3 Antibody (CBMOAB-13806FYA) |
MO-AB-23097H | Mouse Anti-Mallard COX3 Antibody (MO-AB-23097H) |
MO-AB-11300H | Mouse Anti-Malaria parasite cox3 Antibody (MO-AB-11300H) |
MO-AB-01384Y | Mouse Anti-Chicken COX3 Antibody (MO-AB-01384Y) |
MO-AB-43025W | Mouse Anti-Hamsters COX3 Antibody (MO-AB-43025W) |
MO-AB-29848W | Mouse Anti-Dog COX3 Antibody (MO-AB-29848W) |
MO-AB-24815R | Mouse Anti-Pig COX3 Antibody (MO-AB-24815R) |
MO-AB-44164W | Mouse Anti-Horse COX3 Antibody (MO-AB-44164W) |
MO-AB-24825R | Mouse Anti-Pig COX3 Antibody (MO-AB-24825R) |
MO-AB-36973W | Mouse Anti-Goat COX3 Antibody (MO-AB-36973W) |
For Research Use Only | Not For Clinical Use.