Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-C. elegans COX3 Antibody (CBMOAB-00021HCB)


Cat: CBMOAB-00021HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
CloneMO00021HB
SpecificityThis antibody binds to C. elegans COX3.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Product OverviewMouse Anti-C. elegans COX3 (clone MO00021HB) Antibody (CBMOAB-00021HCB) is a mouse antibody against COX3. It can be used for COX3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namescytochrome c oxidase subunit III; COX3
Gene ID2565701
UniProt IDP24891
Protein RefseqThe length of the protein is 255 amino acids long. The sequence is show below: MFHNFHILSLSSYAYNLFFASAGMLSSLVMFFKFGLYELFIFTLFSVLFISFAWGKDIAMEGLSGYHNFFVMDGFKFGVILFVFSEFMFFFCIFCTFFDAALVPVHELGETWSPFGMHLVNPFGVPLLNTIILLSSGVTVTWAHHSLLSNKSCTNSMILTCLLAAYFTGIQLMEYMEASFSIADGVFGSIFYLSTGFHGIHVLCGGLFLAFNFLRLLKNHFNYNHHLGLEFAILYWHFVDVVWLFLFVFVYWWSY.
For Research Use Only | Not For Clinical Use.

Online Inquiry