Mouse Anti-C. elegans CSP1 (clone MO02219HB) Antibody (CBMOAB-02219HCB)


Cat: CBMOAB-02219HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
CloneMO02219HB
SpecificityThis antibody binds to C. elegans CSP1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCysteine protease which, in vitro, cleaves itself and caspase ced-3 into their mature active forms (PubMed:9857046). Also cleaves, in vitro, inactive caspase csp-2 isoform b (PubMed:9857046). Required maternally to induce apoptosis in a subset of cells fated to die during embryogenesis, mostly independently of the ced-9, ced-4 and ced-3 canonical apoptosis pathway (PubMed:23505386). Involved in the degeneration of dopaminergic CEP neurons in response to high Mn levels (PubMed:23721876).
Product OverviewMouse Anti-C. elegans CSP1 (clone MO02219HB) Antibody (CBMOAB-02219HCB) is a mouse antibody against CSP1. It can be used for CSP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCaspase-related protein 1C; Protein CSP-1, isoform c; csp-1
UniProt IDG5EBN4
Protein RefseqThe length of the protein is 149 amino acids long. The sequence is show below: MPRTDAKKSNHKHKYCYEMNSNPRGTVLILSNENFKNMERRVGTKQDEVNLTKLFQKLQYTVICKRNLEAESMLEAIKEFAEMAHTDSIILFLLSHGDGAGSVFGIDDMPVNVMEVSTYLAYHQNLLLKPKWVAVSACRGGKIEHGCSR.
For Research Use Only | Not For Clinical Use.

Online Inquiry