Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-C. elegans CYP13A12 Antibody (CBMOAB-00033HCB)


Cat: CBMOAB-00033HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
CloneMO00033HB
SpecificityThis antibody binds to C. elegans CYP13A12.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-C. elegans CYP13A12 (clone MO00033HB) Antibody (CBMOAB-00033HCB) is a mouse antibody against CYP13A12. It can be used for CUTL31 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCYtochrome P450 family; cyp-13A12
Gene ID184473
UniProt IDO17807
Protein RefseqThe length of the protein is 518 amino acids long. The sequence is show below: MAIIFLAILTSIIGVLSFYLWTWSYWKRRGIAGPSGYPILGSALEMLSSENPPYLQLKEWTKQYGKVYGITEGLSRTLVISDPDLVQEVFVKQYDNFFGRKLNPIQGDPNKDKRVNLFSSQGHRWKRLRTISSPTFSNNSLRKLKTTVEECAVELLRHIEQHTDGGQPIDLLDFYQEFTLDVIGRIAMGQTDSQMFKNPLLPYVRAVFGEPRKGLFLSGSLAPWIGPILRMVMFSLPNIVKNPAVHVIRHTSNAVEQRVKLRMADEKAGIDPGEPQDFIDLFLDAKSDDVELENNEDFTKAGVKVTRQLTTEEIVGQCFVFLIAGFDTTALSLSYSSFLLATHPKVQKKLQEEIDRECADPEVTFDQLSKLKYMECVIKETLRMYPLGALANSRCCMRATKIGNYEIDEGTNILCDTWTLHSDKSIWGEDAEEFKPERWESGDEHFYQKGGYIPFGLGPRQCIGMRLAYMEEKLLLSHILRKYTLEVCNKTQIPLKLIGSRTTQPESVWLNLTPRDDN.
For Research Use Only | Not For Clinical Use.

Online Inquiry