Cat: CBMOAB-02448HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans) |
| Clone | MO02448HB |
| Specificity | This antibody binds to C. elegans D1005.1. |
| Format | Lyophilized |
| Storage | Store at 4°C: short-term (1-2 weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-C. elegans D1005.1 (clone MO02448HB) Antibody (CBMOAB-02448HCB) is a mouse antibody against D1005.1. It can be used for D1005.1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Putative uncharacterized protein D1005.1; D1005.1 |
| UniProt ID | G5EDQ8 |
| Protein Refseq | The length of the protein is 65 amino acids long. The sequence is show below: LISSLTSGLLTIGDRFGGALDGAARQFSEAFDQGWSANQFVSEMRKKGKHIMGIGHRVKSINXPD. |
See other products for " D1005.1 "
| CBMOAB-02464HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-02464HCB) |
| CBMOAB-02452HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-02452HCB) |
| CBMOAB-00036HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-00036HCB) |
| CBMOAB-00037HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-00037HCB) |
| CBMOAB-02459HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-02459HCB) |
| CBMOAB-02461HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-02461HCB) |
| CBMOAB-02462HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-02462HCB) |
| CBMOAB-02458HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-02458HCB) |
| CBMOAB-02454HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-02454HCB) |
| CBMOAB-02455HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-02455HCB) |
For Research Use Only | Not For Clinical Use.