Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-02453HCB)

Cat: CBMOAB-02453HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details


Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
SpecificityThis antibody binds to C. elegans D1005.1.
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.


Product OverviewMouse Anti-C. elegans D1005.1 (clone MO02453HB) Antibody (CBMOAB-02453HCB) is a mouse antibody against D1005.1. It can be used for D1005.1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative uncharacterized protein D1005.1; D1005.1
UniProt IDQ2Q3B4
Protein RefseqThe length of the protein is 76 amino acids long. The sequence is show below: DLISSLTSGLLTIGDRFGGALDGAARQFSEAFDQGWSANQFVSEMRKKGKHIMGIGHRVKSINNPDKRVEILKRFA.
For Research Use Only | Not For Clinical Use.

Online Inquiry