Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-02457HCB)


Cat: CBMOAB-02457HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
CloneMO02457HB
SpecificityThis antibody binds to C. elegans D1005.1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-C. elegans D1005.1 (clone MO02457HB) Antibody (CBMOAB-02457HCB) is a mouse antibody against D1005.1. It can be used for D1005.1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative uncharacterized protein D1005.1; D1005.1
UniProt IDQ2Q3C4
Protein RefseqThe length of the protein is 66 amino acids long. The sequence is show below: LIXSLTSGLLTIGDRFGGALDGAARQFSEAFDQGWSANQFVSEMRKKGKHIMGIGHRVKSINNPXX.
For Research Use Only | Not For Clinical Use.

Online Inquiry