Cat: CBMOAB-02459HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | C. elegans (Caenorhabditis elegans) |
Clone | MO02459HB |
Specificity | This antibody binds to C. elegans D1005.1. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2 weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-C. elegans D1005.1 (clone MO02459HB) Antibody (CBMOAB-02459HCB) is a mouse antibody against D1005.1. It can be used for D1005.1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Putative uncharacterized protein D1005.1; D1005.1 |
UniProt ID | Q2Q3D1 |
Protein Refseq | The length of the protein is 74 amino acids long. The sequence is show below: VCARAGKDLISSLTSGLLTIGDRFGGALDGAARQFSEAFDQGWSANQFVSEMRKKGKHIMGIGHRVKSINNPDK. |
See other products for " D1005.1 "
CBMOAB-02452HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-02452HCB) |
CBMOAB-02449HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-02449HCB) |
CBMOAB-02460HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-02460HCB) |
CBMOAB-02451HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-02451HCB) |
CBMOAB-00037HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-00037HCB) |
CBMOAB-02465HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-02465HCB) |
CBMOAB-02447HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-02447HCB) |
CBMOAB-02462HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-02462HCB) |
CBMOAB-02454HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-02454HCB) |
CBMOAB-00036HCB | Mouse Anti-C. elegans D1005.1 Antibody (CBMOAB-00036HCB) |
For Research Use Only | Not For Clinical Use.