Mouse Anti-C. elegans DAD1 (clone MO02474HB) Antibody (CBMOAB-02474HCB)


Cat: CBMOAB-02474HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
CloneMO02474HB
SpecificityThis antibody binds to C. elegans DAD1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line. The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis. DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes.
Product OverviewMouse Anti-C. elegans DAD1 (clone MO02474HB) Antibody (CBMOAB-02474HCB) is a mouse antibody against DAD1. It can be used for DAD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad-1; Oligosaccharyl transferase subunit dad-1; EC 2.4.99.18; Defender against cell death 1; Protein dad-1; dad-1
UniProt IDP52872
Protein RefseqThe length of the protein is 113 amino acids long. The sequence is show below: MAAQVVPVLSKLFDDYQKTTSSKLKIIDAYMTYILFTGIFQFIYCLLVGTFPFNSFLSGFISTVTSFVLASCLRMQVNQENRSEFTAVSTERAFADFIFANLILHLVVVNFLG.
For Research Use Only | Not For Clinical Use.

Online Inquiry