Mouse Anti-C. elegans DAF22 Antibody (CBMOAB-00038HCB)


Cat: CBMOAB-00038HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
CloneMO00038HB
SpecificityThis antibody binds to C. elegans DAF22.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPeroxisome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes the thiolytic cleavage of 3-ketoacyl-CoA with 8-16 carbon residues in the acyl group using a ping-pong mechanism whereby binding to 3-ketooctanoyl-CoA results in the release of acetyl-CoA and the subsequent addition of CoA produces 3-ketohexanohyl-CoA (PubMed:9151950). Involved in the biosynthesis of the dauer pheromone by providing short chains of fatty acid that are attached to the ascarylose sugars of the pheromone (PubMed:19496754, PubMed:19174521).
Product OverviewMouse Anti-C. elegans DAF22 (clone MO00038HB) Antibody (CBMOAB-00038HCB) is a mouse antibody against DAF22. It can be used for DAF22 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNon-specific lipid-transfer protein-like 2; daf-22
Gene ID174881
UniProt IDG5EDP2
Protein RefseqThe length of the protein is 412 amino acids long. The sequence is show below: MTPTKPKVYIVGVGMTKFCKPGSVPGWDYPDMVKEAVTTALDDCKMKYSDIQQATVGYLFGGTCCGQRALYEVGLTGIPIFNVNNACASGSSGLFLGKQIIESGNSDVVLCAGFERMAPGSLENLAAPIDDRALSVDKHISVMSETYGLEPAPMTAQMFGNAAKEHMEKYGSKREHYAKIAYKNHLHSVHNPKSQFTKEFSLDQVINARKIYDFMGLLECSPTSDGAAAAVLVSEKFLEKNPRLKAQAVEIVGLKLGTDEPSVFAENSNIKMIGFDMIQKLAKQLWAETKLTPNDVQVIELHDCFAPNELITYEAIGLCPVGQGHHIVDRNDNTYGGKWVINPSGGLISKGHPIGATGVAQAVELSNQLRGKCGKRQVPNCKVAMQHNIGIGGAGVVGLYRLGFPGAAQSKI.
For Research Use Only | Not For Clinical Use.

Online Inquiry