Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-C. elegans DAF22 Antibody (CBMOAB-00038HCB)


Cat: CBMOAB-00038HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
CloneMO00038HB
SpecificityThis antibody binds to C. elegans DAF22.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPeroxisome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes the thiolytic cleavage of 3-ketoacyl-CoA with 8-16 carbon residues in the acyl group using a ping-pong mechanism whereby binding to 3-ketooctanoyl-CoA results in the release of acetyl-CoA and the subsequent addition of CoA produces 3-ketohexanohyl-CoA (PubMed:9151950). Involved in the biosynthesis of the dauer pheromone by providing short chains of fatty acid that are attached to the ascarylose sugars of the pheromone (PubMed:19496754, PubMed:19174521).
Product OverviewMouse Anti-C. elegans DAF22 (clone MO00038HB) Antibody (CBMOAB-00038HCB) is a mouse antibody against DAF22. It can be used for DAF22 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNon-specific lipid-transfer protein-like 2; daf-22
Gene ID174881
UniProt IDG5EDP2
Protein RefseqThe length of the protein is 412 amino acids long. The sequence is show below: MTPTKPKVYIVGVGMTKFCKPGSVPGWDYPDMVKEAVTTALDDCKMKYSDIQQATVGYLFGGTCCGQRALYEVGLTGIPIFNVNNACASGSSGLFLGKQIIESGNSDVVLCAGFERMAPGSLENLAAPIDDRALSVDKHISVMSETYGLEPAPMTAQMFGNAAKEHMEKYGSKREHYAKIAYKNHLHSVHNPKSQFTKEFSLDQVINARKIYDFMGLLECSPTSDGAAAAVLVSEKFLEKNPRLKAQAVEIVGLKLGTDEPSVFAENSNIKMIGFDMIQKLAKQLWAETKLTPNDVQVIELHDCFAPNELITYEAIGLCPVGQGHHIVDRNDNTYGGKWVINPSGGLISKGHPIGATGVAQAVELSNQLRGKCGKRQVPNCKVAMQHNIGIGGAGVVGLYRLGFPGAAQSKI.
For Research Use Only | Not For Clinical Use.

Online Inquiry