Cat: CBMOAB-02891HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans) |
| Clone | MO02891HB |
| Specificity | This antibody binds to C. elegans DPM1. |
| Format | Lyophilized |
| Storage | Store at 4°C: short-term (1-2 weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Endoplasmic reticulum |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Dolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mannose and dolichol-phosphate on the cytosolic side of the ER by the enzyme dolichyl-phosphate mannosyltransferase. Human DPM1 lacks a carboxy-terminal transmembrane domain and signal sequence and is regulated by DPM2. Mutations in this gene are associated with congenital disorder of glycosylation type Ie. Alternative splicing results in multiple transcript variants. |
| Product Overview | Mouse Anti-C. elegans DPM1 (clone MO02891HB) Antibody (CBMOAB-02891HCB) is a mouse antibody against DPM1. It can be used for DPM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein DPM-1, isoform b; dpm-1 |
| UniProt ID | U4PF58 |
| Protein Refseq | The length of the protein is 51 amino acids long. The sequence is show below: MEMMFRAKKSGYRIGEVPISFVDRFFGESKLGSQEIVDYAKGLLYLFAFVW. |
See other products for " DPM1 "
| MO-AB-13669W | Mouse Anti-Chimpanzee DPM1 Antibody (MO-AB-13669W) |
| CBMOAB-41143FYA | Mouse Anti-Rhesus DPM1 Antibody (CBMOAB-41143FYA) |
| CBMOAB-74046FYA | Mouse Anti-Zebrafish dpm1 Antibody (CBMOAB-74046FYA) |
| CBMOAB-01070CR | Mouse Anti-Yeast DPM1 Antibody (CBMOAB-01070CR) |
| MO-AB-11629R | Mouse Anti-Cattle DPM1 Antibody (MO-AB-11629R) |
| CBMOAB-41142FYA | Mouse Anti-Rhesus DPM1 Antibody (CBMOAB-41142FYA) |
| MO-AB-25442R | Mouse Anti-Pig DPM1 Antibody (MO-AB-25442R) |
| CBMOAB-41141FYA | Mouse Anti-Rhesus DPM1 Antibody (CBMOAB-41141FYA) |
| MO-AB-11628R | Mouse Anti-Cattle DPM1 Antibody (MO-AB-11628R) |
| MO-AB-43086W | Mouse Anti-Hamsters DPM1 Antibody (MO-AB-43086W) |
For Research Use Only | Not For Clinical Use.