Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-C. elegans END1 Antibody (CBMOAB-00053HCB)


Cat: CBMOAB-00053HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
CloneMO00053HB
SpecificityThis antibody binds to C. elegans END1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-C. elegans END1 (clone MO00053HB) Antibody (CBMOAB-00053HCB) is a mouse antibody against END1. It can be used for END1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGATA-type domain-containing protein; end-1
Gene ID179893
UniProt IDG5EDN4
Protein RefseqThe length of the protein is 221 amino acids long. The sequence is show below: MYQSSSSSPSPHLPYTYGVIDKDGNVHSHEMHFPDNHGNPSPLDATQMYQQAPVQYGGGDQYFDDFGQYFVQSYDPAQQSTPVHPMFGSLDMMNCYSQQYPQIGQDYQQQEIENIPPVSTNRKIVNKKPSTFHTNSVCSNPNCRTRETTLWRRTDSGAIECNGCSLYFRKNGIQRPAELCRKTIMKRNRRPRAEVQSPTPEDSKLCHNTTPLQNIPSQHFS.
For Research Use Only | Not For Clinical Use.

Online Inquiry