Mouse Anti-C. elegans HDA6 Antibody (CBMOAB-04866HCB)


Cat: CBMOAB-04866HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
CloneMO04866HB
SpecificityThis antibody binds to C. elegans HDA6.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-C. elegans HDA6 (clone MO04866HB) Antibody (CBMOAB-04866HCB) is a mouse antibody against HDA6. It can be used for HDA6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein HDA-6, isoform d; hda-6
UniProt IDG8JYB7
Protein RefseqThe length of the protein is 138 amino acids long. The sequence is show below: MADQSSSSGSSSSSTRPSHNLEIMDSGPAHAVVPLATCPHLKEVKPLPPAKINARTACSECQIGAEVWTCLTCYKYNCGRFVNEHAMMHHLSSSHPMALSMADLSVWCYPCDSYVHNPALIGAKSAAHESKFGETMPS.
For Research Use Only | Not For Clinical Use.

Online Inquiry