Cat: CBMOAB-05961HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | C. elegans (Caenorhabditis elegans) |
Clone | MO05961HB |
Specificity | This antibody binds to C. elegans LGG2. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2 weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-C. elegans LGG2 (clone MO05961HB) Antibody (CBMOAB-05961HCB) is a mouse antibody against LGG2. It can be used for LGG2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein lgg; lgg-2 |
UniProt ID | E2JKY9 |
Protein Refseq | The length of the protein is 74 amino acids long. The sequence is show below: MDRCKFLVPEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQPAFG. |
Reference
See other products for " LGG2 "
CBMOAB-05962HCB | Mouse Anti-C. elegans LGG2 Antibody (CBMOAB-05962HCB) |
For Research Use Only | Not For Clinical Use.