Mouse Anti-C. elegans LGG2 Antibody (CBMOAB-05962HCB)
Cat: CBMOAB-05962HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Specifications
- Application Information
- Target
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | C. elegans (Caenorhabditis elegans) |
Clone | MO05962HB |
Specificity | This antibody binds to C. elegans LGG2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma Membrane; Other locations; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ubiquitin-like modifier involved in the formation of autophagosomal vacuoles (autophagosomes) (PubMed:26687600). When lipidated mediates tethering between adjacent membranes and stimulates membrane fusion (PubMed:26687600). Less effective at promoting membrane fusion than lgg-1 (PubMed:26687600). Acts upstream of the autophagy protein epg-5 in the aggrephagy pathway, which is the macroautophagic degradation of ubiquitinated protein aggregates, and preferentially interacts with autophagy proteins and substrates containing LIR motifs to mediate autophagosome formation and protein aggregate degradation (PubMed:26687600). In particular binds to components of an atg-5-lgg-3-atg-16 complex to regulate autophagosome formation and cargo sequestration (PubMed:26687600). Required for the degradation of specific sqst-1-containing aggregates during embryogenesis and the early stages of larval development (PubMed:26687600). Involved in allophagy, which is an autophagic process in which paternal mitochondria and organelles are degraded during fertilization, and moreover is required for the degradation of lgg-1-positive allophagic autophagosomes in embryos (PubMed:25126728, PubMed:24374177). Through HOPS complex subunit vps-39, tethers lysosomes with autophagosomes to form autolysosomes (PubMed:24374177). Plays a role in the distribution and clearance of germ cell specific P-granules from somatic cells to ensure exclusive localization of the P-granules in germ cells (PubMed:19167332). Essential for dauer development and life-span extension (PubMed:20523114). (From uniprot, under CC BY 4.0) |
Product Overview | Mouse Anti-C. elegans LGG2 Antibody is a mouse antibody against LGG2. It can be used for LGG2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein lgg-2; lgg-2 |
UniProt ID | Q23536 |
Protein Refseq | The length of the protein is 130 amino acids long. The sequence is show below: MSGNRGGSYISGIVPSFKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRCKFLVPEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQPAFG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry