Rabbit Anti-C12ORF73 Antibody (Cat MO-DKB-03285W)
Cat: MO-DKB-03285W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Specifications
- Application Information
- Target
Specifications
| Host species | Rabbit (Oryctolagus cuniculus) |
| Species Reactivity | Human (Homo sapiens), Zebrafish (Danio rerio) |
| Specificity | This antibody is binds to Human C12orf73 and has cross reactivity with Zebrafish C12orf73. |
| Immunogen | The antibody was developed against a recombinant protein corresponding to the following amino acids: AEVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKHKPQVSQQEEL |
| Format | Liquid or Lyophilized |
| Buffer | PBS, pH 7.2, 40% Glycerol |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purification | Affinity purified |
Application Information
| Application | WB, IF, IHC, IHC-P, KD, KO |
| Application Notes | Western Blot: 0.04-0.4 ug/mL Immunocytochemistry/Immunofluorescence: 0.25-2 ug/mL Immunohistochemistry: 1:200-1:500 Immunohistochemistry-Paraffin: 1:200-1:500 The optimal dilution should be determined by the end user. |
Target
| Introduction | C12orf73 (Chromosome 12 Open Reading Frame 73) is a Protein Coding gene. |
| Product Overview | This product is a Rabbit antibody against the C12orf73. It can be used for C12orf73 detection in Western Blot, Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated, Knockout Validated. |
| Alternative Names | Chromosome 12 Open Reading Frame 73; |
| Gene ID | 728568 |
| UniProt ID | Q69YU5 |
For Research Use Only | Not For Clinical Use.
Online Inquiry