Rabbit Anti-C12ORF73 Antibody (Cat MO-DKB-03285W)


Cat: MO-DKB-03285W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesRabbit (Oryctolagus cuniculus)
Species ReactivityHuman (Homo sapiens), Zebrafish (Danio rerio)
SpecificityThis antibody is binds to Human C12orf73 and has cross reactivity with Zebrafish C12orf73.
ImmunogenThe antibody was developed against a recombinant protein corresponding to the following amino acids: AEVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKHKPQVSQQEEL
FormatLiquid or Lyophilized
BufferPBS, pH 7.2, 40% Glycerol
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
PurificationAffinity purified

Application Information

ApplicationWB, IF, IHC, IHC-P, KD, KO
Application NotesWestern Blot: 0.04-0.4 ug/mL
Immunocytochemistry/Immunofluorescence: 0.25-2 ug/mL
Immunohistochemistry: 1:200-1:500
Immunohistochemistry-Paraffin: 1:200-1:500
The optimal dilution should be determined by the end user.

Target

IntroductionC12orf73 (Chromosome 12 Open Reading Frame 73) is a Protein Coding gene.
Product OverviewThis product is a Rabbit antibody against the C12orf73. It can be used for C12orf73 detection in Western Blot, Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated, Knockout Validated.
Alternative NamesChromosome 12 Open Reading Frame 73;
Gene ID728568
UniProt IDQ69YU5
For Research Use Only | Not For Clinical Use.
Online Inquiry