Mouse Anti-C1QL1 Antibody (CBMOAB-37593FYA)


Cat: CBMOAB-37593FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37593FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO37593FYA 100 µg
MO-AB-24453H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24453C 100 µg
MO-AB-52014W Monoclonal Marmoset WB, ELISA MO52014W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus)
CloneMO37593FYA
SpecificityThis antibody binds to Rhesus C1QL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionC1QL1 (Complement C1q Like 1) is a Protein Coding gene. An important paralog of this gene is C1QL3.
Product OverviewMouse Anti-Rhesus C1QL1 Antibody is a mouse antibody against C1QL1. It can be used for C1QL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC1q-related factor; C1QL1
UniProt IDH9F9W8
Protein RefseqThe length of the protein is 195 amino acids long.
The sequence is show below: LVQGPQGKPGRTGKPGPPGPPGDPGPPGPVGPPGEKGEPGKPGPPGLPGAGGSGAISTATYTTVPRVAFYAGLKNPHEGYEVLKFDDVVTNLGNNYDAASGKFTCNIPGTYFFTYHVLMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVILHLDAGDEVFIKLDGGKAHGGNSNKYSTFSGFIIYSD.
For Research Use Only | Not For Clinical Use.
Online Inquiry