Mouse Anti-C1QTNF2 Antibody (MO-AB-17835W)


Cat: MO-AB-17835W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-17835W Monoclonal Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rhesus (Macaca mulatta) WB, ELISA MO17835W 100 µg
CBMOAB-37600FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO37600FYA 100 µg
MO-AB-24219R Monoclonal Pig (Sus scrofa) WB, ELISA MO24219R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Pig (Sus scrofa), Rhesus (Macaca mulatta)
CloneMO17835W
SpecificityThis antibody binds to Chimpanzee C1QTNF2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionC1QTNF2 (C1q And TNF Related 2) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include identical protein binding and receptor binding. An important paralog of this gene is C1QTNF7.
Product OverviewMouse Anti-Chimpanzee C1QTNF2 Antibody is a mouse antibody against C1QTNF2. It can be used for C1QTNF2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC1q and tumor necrosis factor related protein 2; C1QTNF2
UniProt IDH2QRX8
Protein RefseqThe length of the protein is 330 amino acids long.
The sequence is show below: MGKLCLGPALGPAAAAEESRDAEPRRELLCSGRPWTWRAAARVTTMIPWVLLACALPCAADPLLGAFARRDFRKGSPQLICSLPGPQGPPGPPGAPGPSGMMGRMGFPGKDGQDGHDGDQGDSGEEGPPGRTGNRGKPGPKGKAGAIGRAGPRGPKGVNGTPGKHGTPGKKGPKGKKGEPGLPGPCSCGSGHTKSAFSVAVTKSYPRERLPIKFDKILMNEGGHYNASSGKFVCGVPGIYYFTYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTILALKQGDEVWLQIFYSEQNGLFYDPYWTDSLFTGFLIYADQDDPNEV.
See other products for " c1qtnf2 "
For Research Use Only | Not For Clinical Use.
Online Inquiry