Mouse Anti-C1QTNF6 Antibody (CBMOAB-37602FYA)


Cat: CBMOAB-37602FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37602FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa) WB, ELISA MO37602FYA 100 µg
MO-AB-09269R Monoclonal Cattle (Bos taurus) WB, ELISA MO09269R 100 µg
MO-AB-22413W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22413W 100 µg
MO-AB-24222R Monoclonal Pig (Sus scrofa) WB, ELISA MO24222R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa)
CloneMO37602FYA
SpecificityThis antibody binds to Rhesus C1QTNF6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus C1QTNF6 Antibody is a mouse antibody against C1QTNF6. It can be used for C1QTNF6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC1QTNF6
UniProt IDF6XSM3
Protein RefseqThe length of the protein is 278 amino acids long.
The sequence is show below: MQWLRVRDSPGEATGHRVTMGTAALGPLWAVLLLFLLMCEVPKVELTFDRAVASGCQRCCDSEDPLDPAHVSSASSSGLPHALPEIRPYINITILKGDKGDPGAMGLPGHMGREGPQGEPGPQGSKGDKGEMGSPSAPCQKRFFAFSVGRKTALHSGEDFQRLLFERVFVNLDGCFDMAAGHFAAPLRGIYFFSLNVHSWNYKETYVHIMHNQKEAVILYAQPSERSIMQSQSVMLDLAYGDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDD.
For Research Use Only | Not For Clinical Use.
Online Inquiry