Mouse Anti-C1QTNF7 Antibody (CBMOAB-37603FYA)


Cat: CBMOAB-37603FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37603FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa) WB, ELISA MO37603FYA 100 µg
MO-AB-01398W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01398W 100 µg
MO-AB-09270R Monoclonal Cattle (Bos taurus) WB, ELISA MO09270R 100 µg
MO-AB-24223R Monoclonal Pig (Sus scrofa) WB, ELISA MO24223R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa)
CloneMO37603FYA
SpecificityThis antibody binds to Rhesus C1QTNF7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionC1QTNF7 (C1q And TNF Related 7) is a Protein Coding gene. An important paralog of this gene is C1QTNF2.
Product OverviewMouse Anti-Rhesus C1QTNF7 Antibody is a mouse antibody against C1QTNF7. It can be used for C1QTNF7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC1QTNF7
UniProt IDF7E5R5
Protein RefseqThe length of the protein is 289 amino acids long.
The sequence is show below: MFVLLYVTSFAICASGQPRGNQLKGENYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGLPGRDGRDGRKGEKGEKGTAGLRGKTGPLGLAGEKGDQGETGKKGPMGPEGEKGEVGPAGPPGPKGDRGEQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERLPIVFNKVLFNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIKTFDANTGNHDVASGSTVIYLQPEDEVWLEIFFTDQNGLFSDPGWADSLFSGFLLYVDTDYLDSISEDDEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry