Mouse Anti-C1QTNF9 Antibody (CBMOAB-37608FYA)


Cat: CBMOAB-37608FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37608FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio) WB, ELISA MO37608FYA 100 µg
CBMOAB-68283FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO68283FYA 100 µg
MO-AB-09272R Monoclonal Cattle (Bos taurus) WB, ELISA MO09272R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio)
CloneMO37608FYA
SpecificityThis antibody binds to Rhesus C1QTNF9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus C1QTNF9 Antibody is a mouse antibody against C1QTNF9. It can be used for C1QTNF9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesComplement C1q tumor necrosis factor-related protein 9A; C1QTNF9
UniProt IDI0FRD9
Protein RefseqThe length of the protein is 333 amino acids long.
The sequence is show below: MRIWWFLLAIGICAGNISSQNTCRQGHPGIPGNPGHNGLPGRDGRDGVKGDKGDAGEPGRPGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGDIGPLGPTGLPGSMGPIGKPGPKGEAGPMGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDVPIKFDKILYNEFNHYDIATGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGLVLPLKLGDEVWLQVTGGDRFSGLFADEDDDTTFTGFLLFGSP.
For Research Use Only | Not For Clinical Use.
Online Inquiry