Mouse Anti-C1R Antibody (CBMOAB-37609FYA)


Cat: CBMOAB-37609FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37609FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Zebrafish (Danio rerio) WB, ELISA MO37609FYA 100 µg
CBMOAB-68285FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO68285FYA 100 µg
MO-AB-01970H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01970C 100 µg
MO-AB-09273R Monoclonal Cattle (Bos taurus) WB, ELISA MO09273R 100 µg
MO-AB-26532W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26532W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Zebrafish (Danio rerio)
CloneMO37609FYA
SpecificityThis antibody binds to Rhesus C1R.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionC1R (Complement C1r) is a Protein Coding gene. Diseases associated with C1R include Ehlers-Danlos Syndrome, Periodontal Type, 1 and Periodontal Ehlers-Danlos Syndrome. Among its related pathways are Creation of C4 and C2 activators and Complement and coagulation cascades. Gene Ontology (GO) annotations related to this gene include calcium ion binding and serine-type peptidase activity. An important paralog of this gene is MASP2.
Product OverviewMouse Anti-Rhesus C1R Antibody is a mouse antibody against C1R. It can be used for C1R detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC1R
UniProt IDF7HBM6
Protein RefseqThe length of the protein is 199 amino acids long.
The sequence is show below: LFGEVTSPLFPKPYPNSFETTTMITVPTGYGVKLIFQHFDLEPSEGCSYDYVEVISADTKNLGRFCGQLGSPLGNPPGKKEFISQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQAEKIAHDLRFVRLPCQHLCHNYVGGYFCSCRPGYELQEDRHSCQAECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRVERG.
For Research Use Only | Not For Clinical Use.
Online Inquiry