Mouse Anti-CACNA1C Antibody (CBMOAB-37984FYA)


Cat: CBMOAB-37984FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37984FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Goat (Capra hircus), Guinea pig (Cavia porcellus), Hamster (Cricetulus griseus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB, ELISA MO37984FYA 100 µg
CBMOAB-68670FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO68670FYA 100 µg
MO-AB-01447W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01447W 100 µg
MO-AB-02001H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02001C 100 µg
MO-AB-07392Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07392Y 100 µg
MO-AB-26206W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26206W 100 µg
MO-AB-29301W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29301W 100 µg
MO-AB-36815W Monoclonal Goat (Capra hircus) WB, ELISA MO36815W 100 µg
MO-AB-41329W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41329W 100 µg
MO-AB-52062W Monoclonal Marmoset WB, ELISA MO52062W 100 µg
MO-NAB-00042W Monoclonal Hamster (Cricetulus griseus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus) WB, IHC, IF, IP, AM NW0158 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Goat (Capra hircus), Guinea pig (Cavia porcellus), Hamster (Cricetulus griseus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio)
CloneMO37984FYA
SpecificityThis antibody binds to Rhesus CACNA1C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an alpha-1 subunit of a voltage-dependent calcium channel. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization. The alpha-1 subunit consists of 24 transmembrane segments and forms the pore through which ions pass into the cell. The calcium channel consists of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. There are multiple isoforms of each of these proteins, either encoded by different genes or the result of alternative splicing of transcripts. The protein encoded by this gene binds to and is inhibited by dihydropyridine. Alternative splicing results in many transcript variants encoding different proteins. Some of the predicted proteins may not produce functional ion channel subunits. (From NCBI)
Product OverviewMouse Anti-Rhesus CACNA1C Antibody is a mouse antibody against CACNA1C. It can be used for CACNA1C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesVoltage-dependent L-type calcium channel subunit alpha-1C isoform 17; CACNA1C
UniProt IDH9FJI4
Protein RefseqThe length of the protein is 379 amino acids long.
The sequence is show below: EINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPGNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKAGSSQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNA.
For Research Use Only | Not For Clinical Use.
Online Inquiry