Mouse Anti-CALB1 Antibody (CBMOAB-38025FYA)


Cat: CBMOAB-38025FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38025FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Human, Rat, Mouse, Monkey, Cow, Chicken, Zebrafish, Turtle, Grashopper, Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO38025FYA 100 µg
CBMOAB-68821FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO68821FYA 100 µg
MO-AB-52127W Monoclonal Marmoset WB, ELISA MO52127W 100 µg
MO-AB-24263R Monoclonal Pig (Sus scrofa) WB, ELISA MO24263R 100 µg
MO-AB-02021H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02021C 100 µg
MOFAB-384W Polyclonal Human, Rat, Mouse, Monkey, Cow, Chicken, Zebrafish, Turtle, Grashopper WB, IP, ICC, IHC, IHC-P 100 µg
MOFAB-385W Monoclonal Human, Rat, Mouse, Zebrafish, Grashopper WB, ICC, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Human, Rat, Mouse, Monkey, Cow, Chicken, Zebrafish, Turtle, Grashopper, Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO38025FYA
SpecificityThis antibody binds to Rhesus CALB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCALB1 (Calbindin 1) is a Protein Coding gene. Diseases associated with CALB1 include Huntington Disease and Temporal Lobe Epilepsy. Among its related pathways are Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 and Endocrine and other factor-regulated calcium reabsorption. Gene Ontology (GO) annotations related to this gene include calcium ion binding and vitamin D binding. An important paralog of this gene is CALB2.
Product OverviewMouse Anti-Rhesus CALB1 Antibody is a mouse antibody against CALB1. It can be used for CALB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCALB1
UniProt IDF7H3Y5
Protein RefseqThe length of the protein is 260 amino acids long.
The sequence is show below: MAEFHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHILPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMASNNILTFTLFSVFGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQELDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN.
For Research Use Only | Not For Clinical Use.
Online Inquiry