Mouse Anti-CALB1 Antibody (CBMOAB-38025FYA)
Cat: CBMOAB-38025FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-38025FYA | Monoclonal | Rhesus (Macaca mulatta), Frog (Xenopus laevis), Human, Rat, Mouse, Monkey, Cow, Chicken, Zebrafish, Turtle, Grashopper, Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) | WB, ELISA | MO38025FYA | 100 µg | ||
CBMOAB-68821FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO68821FYA | 100 µg | ||
MO-AB-52127W | Monoclonal | Marmoset | WB, ELISA | MO52127W | 100 µg | ||
MO-AB-24263R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24263R | 100 µg | ||
MO-AB-02021H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02021C | 100 µg | ||
MOFAB-384W | Polyclonal | Human, Rat, Mouse, Monkey, Cow, Chicken, Zebrafish, Turtle, Grashopper | WB, IP, ICC, IHC, IHC-P | 100 µg | |||
MOFAB-385W | Monoclonal | Human, Rat, Mouse, Zebrafish, Grashopper | WB, ICC, IHC, IHC-P | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Frog (Xenopus laevis), Human, Rat, Mouse, Monkey, Cow, Chicken, Zebrafish, Turtle, Grashopper, Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) |
Clone | MO38025FYA |
Specificity | This antibody binds to Rhesus CALB1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Nucleus; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CALB1 (Calbindin 1) is a Protein Coding gene. Diseases associated with CALB1 include Huntington Disease and Temporal Lobe Epilepsy. Among its related pathways are Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 and Endocrine and other factor-regulated calcium reabsorption. Gene Ontology (GO) annotations related to this gene include calcium ion binding and vitamin D binding. An important paralog of this gene is CALB2. |
Product Overview | Mouse Anti-Rhesus CALB1 Antibody is a mouse antibody against CALB1. It can be used for CALB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | CALB1 |
UniProt ID | F7H3Y5 |
Protein Refseq | The length of the protein is 260 amino acids long. The sequence is show below: MAEFHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHILPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMASNNILTFTLFSVFGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQELDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN. |
See other products for " CALB1 "
MOFAB-386W | Mouse Anti-CALB1 Antibody (MOFAB-386W) |
MO-AB-09415R | Mouse Anti-CALB1 Antibody (MO-AB-09415R) |
MO-AB-07415Y | Mouse Anti-CALB1 Antibody (MO-AB-07415Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry