Mouse Anti-Cattle ABCD4 Antibody (MO-AB-06761R)


Cat: MO-AB-06761R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO06761R
SpecificityThis antibody binds to Cattle ABCD4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown. However, it is speculated that it may function as a heterodimer for another peroxisomal ABC transporter and, therefore, may modify the adrenoleukodystrophy phenotype. It may also play a role in the process of peroxisome biogenesis. Alternative splicing results in several protein-coding and non-protein-coding variants.
Product OverviewMouse Anti-Cattle ABCD4 Antibody is a mouse antibody against ABCD4. It can be used for ABCD4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP-binding cassette, sub-family D, member 4 isoform 3; ABCD4
UniProt IDQ5E9I5
Protein RefseqThe length of the protein is 447 amino acids long.
The sequence is show below: MASKLIISPFTLVYYTYQCFRSTSWLGPVSIFGYFILGTVVNRVVMGPIVAKLVQQEKLEGDFRFKHMQIRVNAEPAAFFRAGHVEHMRTDRRLQRLLKTQRELMSKELWLYIGINMFDYLGSILSYIVIAIPIFSGVYGDLSPTELSSLVSKNAFVCMYLINCFSQLIDLCTTLSDVAGYTHRIGELHETLLDMTLKSQDGEFLDESQWDLARGPGGPATEPADTAFLLERVCICAPSSHKPLIKDLSLKISEG.
For Research Use Only | Not For Clinical Use.
Online Inquiry