Mouse Anti-Cattle ABCG2 Antibody (MO-AB-06765R)


Cat: MO-AB-06765R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO06765R
SpecificityThis antibody binds to Cattle ABCG2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Cattle ABCG2 Antibody is a mouse antibody against ABCG2. It can be used for ABCG2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP-binding cassette, sub-family G, member 2; ABCG2
UniProt IDA7E3T8
Protein RefseqThe length of the protein is 658 amino acids long.
The sequence is show below: MLKMSSNSYEVSIPMSKKLNGIPETTSKDLQTLTEGAVLSFHNICYRVKVKTGFLLCRKTIEKEILANINGVMKPGLNAILGPTGGGKSSLLDILAARKDPHGLSGDVLINGAPRPANFKCNSGYVVQDDVVMGTLTVRENLQFSAALRLPTTMTSYEKNERINKVIQELGLDKVADSKVGTQFIRGVSGGERKRTSIAMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIFSIHQPRYSIFKLF.
For Research Use Only | Not For Clinical Use.
Online Inquiry