Mouse Anti-Cattle ABHD12 Antibody (MO-AB-06789R)


Cat: MO-AB-06789R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO06789R
SpecificityThis antibody binds to Cattle ABHD12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme that catalyzes the hydrolysis of 2-arachidonoyl glycerol (2-AG), the main endocannabinoid lipid transmitter that acts on cannabinoid receptors, CB1 and CB2. The endocannabinoid system is involved in a wide range of physiological processes, including neurotransmission, mood, appetite, pain appreciation, addiction behavior, and inflammation. Mutations in this gene are associated with the neurodegenerative disease, PHARC (polyneuropathy, hearing loss, ataxia, retinitis pigmentosa, and cataract), resulting from an inborn error of endocannabinoid metabolism. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Product OverviewMouse Anti-Cattle ABHD12 Antibody is a mouse antibody against ABHD12. It can be used for ABHD12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMonoacylglycerol lipase ABHD12; EC 3.1.1.23; 2-arachidonoylglycerol hydrolase; Abhydrolase domain-containing protein 12; ABHD12
UniProt IDQ08DW9
Protein RefseqThe length of the protein is 398 amino acids long.
The sequence is show below: MRKRTEPVALEHERRTASGSPSAGPAAAALDADCRLKQNLCLAGPGPAEPRCAADAGMKRALGRRKGLCFRLRKILFFVLGLYVAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKRPQDQGLNHTCNYYLQPEEDVTIGVWHTVPTVWWKNAQGKDQMWYEDALSSSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKVRSGDNPVYIWGHSLGTGVATNL.
For Research Use Only | Not For Clinical Use.
Online Inquiry