Mouse Anti-Cattle ABR Antibody (MO-AB-06817R)


Cat: MO-AB-06817R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO06817R
SpecificityThis antibody binds to Cattle ABR.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene.
Product OverviewMouse Anti-Cattle ABR Antibody is a mouse antibody against ABR. It can be used for ABR detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActive breakpoint cluster region-related protein; ABR
UniProt IDA6QNS3
Protein RefseqThe length of the protein is 859 amino acids long.
The sequence is show below: MEPLSHRGLPRLSWIDTLYSNFSYGADDYDAEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDSISPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSRDSHTSVTMEALLYKPIDRVTRSTLVLHDLLK.
For Research Use Only | Not For Clinical Use.
Online Inquiry