Mouse Anti-Cattle ACADL Antibody (MO-AB-06844R)


Cat: MO-AB-06844R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO06844R
SpecificityThis antibody binds to Cattle ACADL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.
Product OverviewMouse Anti-Cattle ACADL Antibody is a mouse antibody against ACADL. It can be used for ACADL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcyl-Coenzyme A dehydrogenase, long chain; ACADL
UniProt IDQ08D92
Protein RefseqThe length of the protein is 430 amino acids long.
The sequence is show below: MAKRLLRGTLRLWGGRAAPCLPPASRCSHSGGEERLETSSAKKLTDIGTRRIFSLEHDIFRESVRKFFQEEVIPYHAEWEKAGEVSRELWEKAGKQGLLGISIADHHGGIGGDLYSSAIVWEEQAYSNCTGPGFGLHSDIVMPYITNYGSEEQIKRFIPEMVAGKCIGAIAMTEPGAGSDLQGIRTNAKKDGSDWILNGSKVFVTNGWLCDIVIIVAITNREAHSPAHGISLFLVENGMKGFIKGRKLDKIGLKA.
For Research Use Only | Not For Clinical Use.
Online Inquiry