Mouse Anti-Cattle ADH4 Antibody (MO-AB-07045R)


Cat: MO-AB-07045R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07045R
SpecificityThis antibody binds to Cattle ADH4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes.
Product OverviewMouse Anti-Cattle ADH4 Antibody is a mouse antibody against ADH4. It can be used for ADH4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADH4 protein; ADH4
UniProt IDA6QPF3
Protein RefseqThe length of the protein is 380 amino acids long.
The sequence is show below: MGTKGKIIKCKAAIAWEANKPLSNEEVEVAPPKDHEVRIQIIATALCHSDAHILHPQFEGGVFPVILGHEAAGIVESIGPGVTNFKPCDKVIPLHAPQCGKCKFCLSPRTNFCGKLKHFKNPMGDQKLMEDGTSRFTCKGKPIYHFMGTSTFSQYTVVSDVNLAKLEDDANLERVCLLGCAFSTGYGAVINNAKVTPGSTCAIFGLGGVGLSAVMGCKASGASRIIVVDINSEKFTKAKALGATDCLNPKDLDKP.
For Research Use Only | Not For Clinical Use.
Online Inquiry