Mouse Anti-Cattle AGO3 Antibody (MO-AB-07127R)


Cat: MO-AB-07127R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07127R
SpecificityThis antibody binds to Cattle AGO3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a tandem cluster of closely related family members including argonaute 4 and eukaryotic translation initiation factor 2C, 1. Two transcript variants encoding distinct isoforms have been identified for this gene.
Product OverviewMouse Anti-Cattle AGO3 Antibody is a mouse antibody against AGO3. It can be used for AGO3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein argonaute-3; Argonaute3; Argonaute RISC catalytic component 3; Eukaryotic translation initiation factor 2C 3; eIF-2C 3; eIF2C 3; AGO3; EIF2C3
UniProt IDQ6T5B7
Protein RefseqThe length of the protein is 861 amino acids long.
The sequence is show below: MEIGSAGPVGAQPLLMVPRRPGYGTMGKPTKLLANCFQVEIPKIDVYLYEVDIKPDKCPRRVNREVVDSMVQHFKVTIFGDRRPVYDGKRSLYTANPLPVATTGVDLDATLPGEGGKDRPFKVSIKFVSRVSWHLLHEVLTGRTLPEPLELDKPISTNPVHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEVLDIHNIDEQPRPLTDSH.
For Research Use Only | Not For Clinical Use.
Online Inquiry