Mouse Anti-Cattle ALG5 Antibody (MO-AB-07250R)


Cat: MO-AB-07250R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07250R
SpecificityThis antibody binds to Cattle ALG5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the glycosyltransferase 2 family. The encoded protein participates in glucosylation of the oligomannose core in N-linked glycosylation of proteins. The addition of glucose residues to the oligomannose core is necessary to ensure substrate recognition, and therefore, effectual transfer of the oligomannose core to the nascent glycoproteins. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Cattle ALG5 Antibody is a mouse antibody against ALG5. It can be used for ALG5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAsparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog; S. cerevisiae; ALG5
UniProt IDQ2KIM7
Protein RefseqThe length of the protein is 286 amino acids long.
The sequence is show below: MAPLLLQLAALGAALVAAALILISFVAFITATEMPQLHRHEEEKFFLNVRGQREALPSIQDSPTKQLSVVVPSYNEEKRLPVMMDEALGYLEDRQKQDPTFTYEVIIVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMDQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKLLTREAASRTFSSLHIERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPF.
For Research Use Only | Not For Clinical Use.
Online Inquiry