Mouse Anti-Cattle BAG3 Antibody (MO-AB-07951R)


Cat: MO-AB-07951R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07951R
SpecificityThis antibody binds to Cattle BAG3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionBAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The protein encoded by this gene contains a WW domain in the N-terminal region and a BAG domain in the C-terminal region. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner. [provided by RefSeq, Jul 2008]
Product OverviewMouse Anti-Cattle BAG3 Antibody is a mouse antibody against BAG3. It can be used for BAG3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBAG3 protein; BAG3
UniProt IDA2VE51
Protein RefseqThe length of the protein is 585 amino acids long.
The sequence is show below: MSAATHSPMVQMASGNGAGDRDPLPPGWEIKIDPQTGWPFFVDHNNRTTTWNDPRVPPEGPKETASSANGPSREGARLLPTREGHAVYPQLRPGYIPIPVLHEGAPSRPHPVFAYSQPGTQRFQTEAAAAAPPRSQSPLRGVAEASQPDKPSAPAAAAAAAAQPPASHGPERSQSPAASDCSSSSSSASLPASTGRSSLGGYQLPRGYISIPVIHEQNVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQG.
For Research Use Only | Not For Clinical Use.
Online Inquiry