Mouse Anti-Cattle BARD1 Antibody (MO-AB-07968R)


Cat: MO-AB-07968R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07968R
SpecificityThis antibody binds to Cattle BARD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein which interacts with the N-terminal region of BRCA1. In addition to its ability to bind BRCA1 in vivo and in vitro, it shares homology with the 2 most conserved regions of BRCA1: the N-terminal RING motif and the C-terminal BRCT domain. The RING motif is a cysteine-rich sequence found in a variety of proteins that regulate cell growth, including the products of tumor suppressor genes and dominant protooncogenes. This protein also contains 3 tandem ankyrin repeats. The BARD1/BRCA1 interaction is disrupted by tumorigenic amino acid substitutions in BRCA1, implying that the formation of a stable complex between these proteins may be an essential aspect of BRCA1 tumor suppression. This protein may be the target of oncogenic mutations in breast or ovarian cancer. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Cattle BARD1 Antibody is a mouse antibody against BARD1. It can be used for BARD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBARD1 protein, Fragment; BARD1
UniProt IDA5PJF0
Protein RefseqThe length of the protein is 203 amino acids long.
The sequence is show below: MQGNRQPRVRSGNQPHPAPAMKPAGRGAWAHSRAALDRLEKLLRCSRCTNILREPVCLGGCEHIFCSNCVSDCIGSECPVCYTPAWIQDVKINRQLDSMIQLCSKLQNLLHDTDLSDLKEKTSRKSLFNDAQSKKNSIKMWFSPRSKKVRYTVSKLSVQTQPSVKNDENAQQTSMYEFVSPSPPVEVSEGPKKPSTRSKKKKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry