Mouse Anti-Cattle BECN1 Antibody (MO-AB-08054R)


Cat: MO-AB-08054R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO08054R
SpecificityThis antibody binds to Cattle BECN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Golgi apparatus; Endosome; Endoplasmic reticulum; Mitochondrion; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Cattle BECN1 Antibody is a mouse antibody against BECN1. It can be used for BECN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBeclin-1; BECN1
UniProt IDQ4A1L4
Protein RefseqThe length of the protein is 448 amino acids long.
The sequence is show below: MEGSKTSSSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLATAQLKPGETQEEEANSGEEPFIETRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLGLELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYA.
See other products for " BECN1 "
MOF032922W146Mouse Anti-BECN1 Antibody (MOF032922W146)
CBMOAB-36911FYAMouse Anti-Rhesus BECN1 Antibody (CBMOAB-36911FYA)
CBMOAB-61781FYCMouse Anti-A. thaliana BECN1 Antibody (CBMOAB-61781FYC)
MO-AB-51843WMouse Anti-Marmoset BECN1 Antibody (MO-AB-51843W)
MO-AB-00292YMouse Anti-Chicken BECN1 Antibody (MO-AB-00292Y)
MO-AB-16088WMouse Anti-Chimpanzee BECN1 Antibody (MO-AB-16088W)
MO-AB-24118RMouse Anti-Pig BECN1 Antibody (MO-AB-24118R)
CBMOAB-67622FYAMouse Anti-Zebrafish becn1 Antibody (CBMOAB-67622FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry