Mouse Anti-Cattle CA2 Antibody (MO-AB-09356R)


Cat: MO-AB-09356R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09356R
SpecificityThis antibody binds to Cattle CA2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Cytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is one of several isozymes of carbonic anhydrase, which catalyzes reversible hydration of carbon dioxide. Defects in this enzyme are associated with osteopetrosis and renal tubular acidosis. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Cattle CA2 (clone MO09356R) Antibody (MO-AB-09356R) is a mouse antibody against CA2. It can be used for CA2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCarbonic anhydrase 2, Fragment; CA2
UniProt IDF1N0H3
Protein RefseqThe length of the protein is 249 amino acids long.
The sequence is show below: GPEHWHKDFPIANGERQSPVDIDTKAVVQDPALKPLALVYGEATSQRMVNNGHSFNVEYDDSQDKAVLKDGPLTGTYRLVQFHFHWGSSDDQGSEHTVDRKKYAAELHLVHWNTKYGDFGTAAQQPDGLAVVGVFLKVGDANPALQKVLDALDSIKTKGKSTDFPNFDPGSLLPNVLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSQQMLKFRTLNFNAEGEPELLMLANWRPAQPLKNRQVRGFPK.

Reference

See other products for " CA2 "

MO-AB-09357RMouse Anti-Cattle CA2 Antibody (MO-AB-09357R)
CBMOAB-25627FYCMouse Anti-Arabidopsis CA2 Antibody (CBMOAB-25627FYC)
MO-AB-07385YMouse Anti-Rabbit CA2 Antibody (MO-AB-07385Y)
MO-DKB-02939WRabbit Anti-CA2 Antibody (MO-DKB-02939W)
MOFY-0722-FY450Rabbit Anti-CA2 Antibody (MOFY-0722-FY450)
MOFY-0722-FY221Rabbit Anti-CA2 Antibody (MOFY-0722-FY221)
MO-AB-01990HMouse Anti-Frog ca2 Antibody (MO-AB-01990H)
MOFY-0722-FY127HRP conjugated antibody to CA2 Antibody (MOFY-0722-FY127)
CBMOAB-68377FYAMouse Anti-Zebrafish ca2 Antibody (CBMOAB-68377FYA)
MOFY-0722-FY99Biotin conjugated antibody to CA2 Antibody (MOFY-0722-FY99)
For Research Use Only | Not For Clinical Use.

Online Inquiry