Mouse Anti-Cattle CAT Antibody (MO-AB-09543R)


Cat: MO-AB-09543R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09543R
SpecificityThis antibody binds to Cattle CAT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPeroxisome; Mitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalase is a homotetramer-containing heme enzyme present in all peroxisomal substrates. It undergoes a disproportionation reaction in which hydrogen peroxide is converted into water and oxygen. Human catalase has the last four amino acids (-KANL) at the extreme C-terminus for peroxisome targeting. The monomeric molecular size of human catalase is 61.3 kDa. Catalase is considered to be an important factor in inflammation, mutagenesis, prevention of apoptosis and stimulation of various tumors. Deletion of catalase can lead to human genetic disease, aperoxidemia, or altitude sickness.
Product OverviewMouse Anti-Cattle CAT Antibody is a mouse antibody against CAT. It can be used for CAT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCatalase; EC 1.11.1.6; CAT
UniProt IDP00432
Protein RefseqThe length of the protein is 527 amino acids long.
The sequence is show below: MADNRDPASDQMKHWKEQRAAQKPDVLTTGGGNPVGDKLNSLTVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVFEHIGKRTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDALLFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLAH.
See other products for " CAT "
MO-AB-14462YMouse Anti-Sheep CAT Antibody (MO-AB-14462Y)
MO-AB-11507WMouse Anti-Chimpanzee CAT Antibody (MO-AB-11507W)
MO-AB-43912WMouse Anti-Horse CAT Antibody (MO-AB-43912W)
MO-AB-34488WMouse Anti-Ferret CAT Antibody (MO-AB-34488W)
CBMOAB-03092FYAMouse Anti-D. melanogaster Cat Antibody (CBMOAB-03092FYA)
MO-NAB-00441WRabbit Anti-CAT Antibody
MO-AB-36864WMouse Anti-Goat CAT Antibody (MO-AB-36864W)
MO-AB-00176LMouse Anti-Elephant CAT Antibody (MO-AB-00176L)
MO-DKB-0095RARabbit Anti-Cat Antibody (MO-DKB-0095RA)
MO-AB-23009HMouse Anti-Mallard CAT Antibody (MO-AB-23009H)
For Research Use Only | Not For Clinical Use.
Online Inquiry