Mouse Anti-Cattle CCT3 Antibody (MO-AB-09754R)


Cat: MO-AB-09754R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09754R
SpecificityThis antibody binds to Cattle CCT3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Plasma membrane; Cytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCT3 (Chaperonin Containing TCP1 Subunit 3) is a Protein Coding gene. Diseases associated with CCT3 include Gallbladder Adenocarcinoma and Adenosquamous Carcinoma. Among its related pathways are Organelle biogenesis and maintenance and Innate Immune System. Gene Ontology (GO) annotations related to this gene include ubiquitin protein ligase binding and unfolded protein binding.
Product OverviewMouse Anti-Cattle CCT3 Antibody is a mouse antibody against CCT3. It can be used for CCT3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-complex protein 1 subunit gamma; TCP-1-gamma; CCT-gamma; CCT3
UniProt IDQ3T0K2
Protein RefseqThe length of the protein is 545 amino acids long.
The sequence is show below: MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKKISIPVDTSNRDTMLNIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTD.
See other products for " cct3 "
CBMOAB-69639FYAMouse Anti-Zebrafish cct3 Antibody (CBMOAB-69639FYA)
MO-AB-23016HMouse Anti-Mallard CCT3 Antibody (MO-AB-23016H)
CBMOAB-01145HCBMouse Anti-C. elegans CCT3 Antibody (CBMOAB-01145HCB)
MO-AB-52511WMouse Anti-Marmoset CCT3 Antibody (MO-AB-52511W)
MO-AB-14484YMouse Anti-Sheep CCT3 Antibody (MO-AB-14484Y)
MO-AB-07414WMouse Anti-Cat CCT3 Antibody (MO-AB-07414W)
CBMOAB-25872FYCMouse Anti-Arabidopsis CCT3 Antibody (CBMOAB-25872FYC)
MOFAB-766WMouse Anti-CCT3 Antibody (MOFAB-766W)
CBMOAB-00635CRMouse Anti-Yeast CCT3 Antibody (CBMOAB-00635CR)
MO-AB-43971WMouse Anti-Horse CCT3 Antibody (MO-AB-43971W)
For Research Use Only | Not For Clinical Use.
Online Inquiry