Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Cattle CD163 Antibody (MO-AB-09774R)


Cat: MO-AB-09774R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09774R
SpecificityThis antibody binds to Cattle CD163.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Extracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle CD163 (clone MO09774R) Antibody (MO-AB-09774R) is a mouse antibody against CD163. It can be used for CD163 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesScavenger receptor cysteine-rich type 1 protein M130; CD antigen CD163; [Cleaved into: Soluble CD163 (sCD163)]; CD163; M130
UniProt IDP85521
Protein RefseqThe length of the protein is 1129 amino acids long.
The sequence is show below: MVLHDNSGSAGFKRCSVHFGPFTLAVVSVLYACLITSALGGTDKELRLVAGQTKCSGRVEVKVQEEWGTVCNTGWDLAAVSVVCKQLGCPSVIKATGWTNSSAGTGRIWMDHVSCRGNESALWDCKHEGWGKHNCTHQQDVGVTCSDGSDLEMRLMNGGNRCSGRIEIKFQGQWGTVCDDNFNLDHASVVCKQLGCGSAVSFSGSANFGEGSGPIWFDDLVCHGNESALWNCRHEGWGKHNCDHAEDAGVICLEG.

See other products for " CD163 "

MO-AB-24431RMouse Anti-Pig CD163 Antibody (MO-AB-24431R)
CBMOAB-00024FYAMouse Anti-Cattle CD163 Antibody (CBMOAB-00024FYA)
MO-AB-01554WMouse Anti-Rhesus CD163 Antibody (MO-AB-01554W)
MO-AB-29444WMouse Anti-Dog CD163 Antibody (MO-AB-29444W)
MO-AB-29442WMouse Anti-Dog CD163 Antibody (MO-AB-29442W)
MO-AB-52530WMouse Anti-Marmoset CD163 Antibody (MO-AB-52530W)
MO-AB-29443WMouse Anti-Dog CD163 Antibody (MO-AB-29443W)
MO-AB-24429RMouse Anti-Pig CD163 Antibody (MO-AB-24429R)
MO-AB-52529WMouse Anti-Marmoset CD163 Antibody (MO-AB-52529W)
MO-AB-24433RMouse Anti-Pig CD163 Antibody (MO-AB-24433R)
For Research Use Only | Not For Clinical Use.

Online Inquiry