Mouse Anti-Cattle CD163 Antibody (MO-AB-09774R)


Cat: MO-AB-09774R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09774R
SpecificityThis antibody binds to Cattle CD163.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Extracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD163 (CD163 Molecule) is a Protein Coding gene. Diseases associated with CD163 include Rosai-Dorfman Disease and Non-Langerhans-Cell Histiocytosis. Among its related pathways are Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers and Binding and Uptake of Ligands by Scavenger Receptors. Gene Ontology (GO) annotations related to this gene include scavenger receptor activity. An important paralog of this gene is CD163L1.
Product OverviewMouse Anti-Cattle CD163 Antibody is a mouse antibody against CD163. It can be used for CD163 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesScavenger receptor cysteine-rich type 1 protein M130; CD antigen CD163; [Cleaved into: Soluble CD163 (sCD163)]; CD163; M130
UniProt IDP85521
Protein RefseqThe length of the protein is 1129 amino acids long.
The sequence is show below: MVLHDNSGSAGFKRCSVHFGPFTLAVVSVLYACLITSALGGTDKELRLVAGQTKCSGRVEVKVQEEWGTVCNTGWDLAAVSVVCKQLGCPSVIKATGWTNSSAGTGRIWMDHVSCRGNESALWDCKHEGWGKHNCTHQQDVGVTCSDGSDLEMRLMNGGNRCSGRIEIKFQGQWGTVCDDNFNLDHASVVCKQLGCGSAVSFSGSANFGEGSGPIWFDDLVCHGNESALWNCRHEGWGKHNCDHAEDAGVICLEG.
For Research Use Only | Not For Clinical Use.
Online Inquiry