Mouse Anti-Cattle CD4 Antibody (MO-AB-09834R)


Cat: MO-AB-09834R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09834R
SpecificityThis antibody binds to Cattle CD4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD4 (CD4 Molecule) is a Protein Coding gene. Diseases associated with CD4 include Okt4 Epitope Deficiency and Pilonidal Sinus. Among its related pathways are G-protein signaling N-RAS regulation pathway and PEDF Induced Signaling. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and enzyme binding.
Product OverviewMouse Anti-Cattle CD4 Antibody is a mouse antibody against CD4. It can be used for CD4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-cell surface glycoprotein CD4; CD4
UniProt IDI0J0K1
Protein RefseqThe length of the protein is 455 amino acids long.
The sequence is show below: MGPGTSLRHLFLVLQLAMLPAGTQGKTVVLGEAGDKAELPCQASQKKNMVFSWKDSSQSNILGKRGLFFYKGTTELSHRVESKKNLWDQGSFPLIIKNLQVTDSGTYTCEVDKKTLEVELQVFRLTASSDTHVLLGQSLTLTLESPSGSNPSVQWKGPGDNNKRDVKSLSLAQVGLQDSGTWTCTISQSQQTLEIKIPIVVLAFQKAPETVYVKEGEQAEFSFPLTFEYENLSGELTWQLANGDSSSQSWVTFTV.

Reference

Reference1. Howard, C. J., Sopp, P., Parsons, K. R., & Finch, J. (1989). In vivo depletion of BoT4 (CD4) and of non-T4/T8 lymphocyte subsets in cattle with monoclonal antibodies. European journal of immunology, 19(4), 757-764.
2. Brooke, G. P., Parsons, K. R., & Howard, C. J. (1998). Cloning of two members of the SIRPα family of protein tyrosine phosphatase binding proteins in cattle that are expressed on monocytes and a subpopulation of dendritic cells and which mediate binding to CD4 T cells. European journal of immunology, 28(1), 1-11.
See other products for " CD4 "
MO-AB-29467WMouse Anti-Dog CD4 Antibody (MO-AB-29467W)
MOFY-0622-FY175Rabbit Anti-CD4 Antibody (MOFY-0622-FY175)
CBMOAB-00150FYAMouse Anti-Horse CD4 Antibody (CBMOAB-00150FYA)
CBMOAB-00060FYAMouse Anti-Cattle CD4 Antibody (CBMOAB-00060FYA)
CBMOAB-00138FYAMouse Anti-Dog CD4 Antibody (CBMOAB-00138FYA)
CBMOAB-00059FYAMouse Anti-Cattle CD4 Antibody (CBMOAB-00059FYA)
CBMOAB-00156FYAMouse Anti-Cat CD4 Antibody (CBMOAB-00156FYA)
CBMOAB-00142FYAMouse Anti-Goat CD4 Antibody (CBMOAB-00142FYA)
CBMOAB-00058FYAMouse Anti-Cattle CD4 Antibody (CBMOAB-00058FYA)
MO-DKB-00481WRabbit Anti-CD4 Antibody (MO-DKB-00481W)
For Research Use Only | Not For Clinical Use.
Online Inquiry