Mouse Anti-Cattle CES1 Antibody (MO-AB-10092R)


Cat: MO-AB-10092R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO10092R
SpecificityThis antibody binds to Cattle CES1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This enzyme is the major liver enzyme and functions in liver drug clearance. Mutations of this gene cause carboxylesterase 1 deficiency. Three transcript variants encoding three different isoforms have been found for this gene.
Product OverviewMouse Anti-Cattle CES1 Antibody is a mouse antibody against CES1. It can be used for CES1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCarboxylesterase 1; Monocyte/macrophage serine esterase 1; CES1
UniProt IDQ2KJ30
Protein RefseqThe length of the protein is 566 amino acids long.
The sequence is show below: MWLFGLVLTSISTFTAWAGQPPSSPVVDTAQGRVLGKHVSLKGFAQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWTFVKNTISHPPMCSQDPVGAQLFSDLFTNRKENISLTFSEDCLYLNIYTPADLTKRSRLPVMVWIHGGGLVVGGASTYDGLALSARENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHWVQENIANFGGDPGSVTIFGESAGAESVSILVLSPLARNLFHRAISESGVALTST.
For Research Use Only | Not For Clinical Use.
Online Inquiry