Mouse Anti-Cattle CKS2 Antibody (MO-AB-10274R)


Cat: MO-AB-10274R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO10274R
SpecificityThis antibody binds to Cattle CKS2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle CKS2 (clone MO10274R) Antibody (MO-AB-10274R) is a mouse antibody against CKS2. It can be used for CKS2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCyclin-dependent kinases regulatory subunit 2; CKS-2; CKS2
UniProt IDQ2KJI1
Protein RefseqThe length of the protein is 79 amino acids long.
The sequence is show below: MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK.

See other products for " CKS2 "

MO-AB-00218LMouse Anti-Elephant CKS2 Antibody (MO-AB-00218L)
MO-AB-10930YMouse Anti-O. mykiss CKS2 Antibody (MO-AB-10930Y)
MO-DKB-01313WRabbit Anti-CKS2 Antibody (MO-DKB-01313W)
MO-AB-24811HMouse Anti-Rat Cks2 Antibody (MO-AB-24811H)
MO-AB-00368HMouse Anti-Arabidopsis CKS2 Antibody (MO-AB-00368H)
CBMOAB-26186FYCMouse Anti-Arabidopsis CKS2 Antibody (CBMOAB-26186FYC)
MO-AB-53081WMouse Anti-Marmoset CKS2 Antibody (MO-AB-53081W)
MO-AB-24624RMouse Anti-Pig CKS2 Antibody (MO-AB-24624R)
MO-AB-12346WMouse Anti-Chimpanzee CKS2 Antibody (MO-AB-12346W)
CBMOAB-70628FYAMouse Anti-Zebrafish cks2 Antibody (CBMOAB-70628FYA)
For Research Use Only | Not For Clinical Use.

Online Inquiry