Mouse Anti-Cattle CRTAM Antibody (MO-AB-10754R)


Cat: MO-AB-10754R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO10754R
SpecificityThis antibody binds to Cattle CRTAM.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCRTAM (Cytotoxic And Regulatory T Cell Molecule) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. Gene Ontology (GO) annotations related to this gene include receptor binding. An important paralog of this gene is CADM1.
Product OverviewMouse Anti-Cattle CRTAM Antibody is a mouse antibody against CRTAM. It can be used for CRTAM detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCRTAM protein; CRTAM
UniProt IDA7YWT5
Protein RefseqThe length of the protein is 390 amino acids long.
The sequence is show below: MWWRVCSLLAWFPLQEAFRTNHMETVPIEEGQTLTLNCTVSQETTSLQWLAPSGFTIFFNEQPALKSSKYQLLHHSSDQLSISVLNVTQHDEGVYKCLHYGKSVRTKEVKVIVLATPVTPTLQVSVIKTHNGEEHVILKCSTVRSKPPPRITWLLGNGMELYGEIHHEYETDGKKCNSTSTLTVHAYGKNSTASCIIRHRGLQGRKLVAPFRFEDLVTDQETTSAALETSSLSSQDPQQPNSTVMEDSSTSEIDK.
See other products for " CRTAM "
CBMOAB-39922FYAMouse Anti-Rhesus CRTAM Antibody (CBMOAB-39922FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry